(data stored in ACNUC7421 zone)

EMBL: CP000820.PE277

CP000820.PE277       Location/Qualifiers
FT   CDS             329996..330460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09746"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY1"
FT                   /protein_id="ABW09746.1"
FT                   /translation="MRDACAGVRQDGPVPPRRSTGRRAIPAPLAPNTAPRAVSVTLPIR
FT                   PGPSAQQALPMPVESSRQPARLRDFPTAMSCGGCAEHWSDLEAAHCRACHQIWPSAVGF
FT                   DDHLVECPAAPEIAPRKPKRIPDQRRRPAEGAEAGPDVPADAARDEWNVA"
     MRDACAGVRQ DGPVPPRRST GRRAIPAPLA PNTAPRAVSV TLPIRPGPSA QQALPMPVES        60
     SRQPARLRDF PTAMSCGGCA EHWSDLEAAH CRACHQIWPS AVGFDDHLVE CPAAPEIAPR       120
     KPKRIPDQRR RPAEGAEAGP DVPADAARDE WNVA                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page