(data stored in ACNUC7421 zone)

EMBL: CP000820.PE279

CP000820.PE279       Location/Qualifiers
FT   CDS             complement(331468..331896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09748"
FT                   /db_xref="GOA:A8LDY3"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY3"
FT                   /protein_id="ABW09748.1"
FT                   /translation="MTASSDPVTSRSAAPASGRPATPGGGRSAPAAVRSALLRYQIIAY
FT                   VVGVVLIALVVVGVPLKYLADEPSVVAAIGPIHGVLYMVYLAATLDLASRIRLPSSRTV
FT                   LVMLAGTIPFLSFVAERKIAGLVRAGLAGAAGTGRAPV"
     MTASSDPVTS RSAAPASGRP ATPGGGRSAP AAVRSALLRY QIIAYVVGVV LIALVVVGVP        60
     LKYLADEPSV VAAIGPIHGV LYMVYLAATL DLASRIRLPS SRTVLVMLAG TIPFLSFVAE       120
     RKIAGLVRAG LAGAAGTGRA PV                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page