(data stored in ACNUC7421 zone)

EMBL: CP000820.PE281

CP000820.PE281       Location/Qualifiers
FT   CDS             complement(333017..334603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09750"
FT                   /db_xref="GOA:A8LDY5"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY5"
FT                   /protein_id="ABW09750.1"
FT                   /translation="MIRDRFISSSSRRRVDGHGTAGGQAGTGDRAETGSVAASAPVSDG
FT                   SGAATATPPSSQDFTSTLRSLLARELTEHDPDTERIRARIAAMDPSAARHLAPAARPVD
FT                   HPVIPAPRTTPLAGTTSPAGAPPPTGPTPSTGPVEPGPAGTPPPAGAAARPRATARQRR
FT                   PRRTRPRLLIPTVVGTAATALVGVVLLSGTLFTPRPDTGTVTAAPTRIPRTASADAGNA
FT                   SPADSLGVTPAPSSAGPPSPAPGDGDPAVLSPEGLPSQGAGTSAAPSGAPDGPASQSDQ
FT                   GTGGSAPQDTRPGSGGSGGNDAAPRRDDSRHSGDWDGSGSADRGSGEADTPPGRDGARR
FT                   DSGDSGDSGGSGGSGGVSVSTAPFSRGQEVSLPTAGCLDWVLFGADGVQTRADIPRPGI
FT                   GTARIERGPGSGSGGFANRFSWHGGRPVSSGSRDDDRLVVEGSVRLDVALAGQARRLDL
FT                   YLGSPDGSVRVTVGDGRNAWSRSVALSARQRGDADGVLSVWLPRGQGSIAVTVAAGSGV
FT                   GLLTLAAGVLY"
     MIRDRFISSS SRRRVDGHGT AGGQAGTGDR AETGSVAASA PVSDGSGAAT ATPPSSQDFT        60
     STLRSLLARE LTEHDPDTER IRARIAAMDP SAARHLAPAA RPVDHPVIPA PRTTPLAGTT       120
     SPAGAPPPTG PTPSTGPVEP GPAGTPPPAG AAARPRATAR QRRPRRTRPR LLIPTVVGTA       180
     ATALVGVVLL SGTLFTPRPD TGTVTAAPTR IPRTASADAG NASPADSLGV TPAPSSAGPP       240
     SPAPGDGDPA VLSPEGLPSQ GAGTSAAPSG APDGPASQSD QGTGGSAPQD TRPGSGGSGG       300
     NDAAPRRDDS RHSGDWDGSG SADRGSGEAD TPPGRDGARR DSGDSGDSGG SGGSGGVSVS       360
     TAPFSRGQEV SLPTAGCLDW VLFGADGVQT RADIPRPGIG TARIERGPGS GSGGFANRFS       420
     WHGGRPVSSG SRDDDRLVVE GSVRLDVALA GQARRLDLYL GSPDGSVRVT VGDGRNAWSR       480
     SVALSARQRG DADGVLSVWL PRGQGSIAVT VAAGSGVGLL TLAAGVLY                    528
//

If you have problems or comments...

PBIL Back to PBIL home page