(data stored in ACNUC7421 zone)

EMBL: CP000820.PE285

CP000820.PE285       Location/Qualifiers
FT   CDS             complement(338215..339744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6598 conserved hypothetical protein;
FT                   putative coiled-coil domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09754"
FT                   /db_xref="GOA:A8LDY9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY9"
FT                   /protein_id="ABW09754.1"
FT                   /translation="MSEGLLVTGTTQAIRASHEILERALELSRADGAIVIASESSTVNL
FT                   RWANNTLTTNGAARDRSVTIISVIGRSFGVRSTSTVDGPGVGADLAGLEALVRASEAAA
FT                   RESDDAEDYSDLVVPAAAAVGGRSFTDPAERTSSEVFASFADDLAEAFGAARAEGRRLF
FT                   GFAEHDRTTTWLGTSTGLRLRHSQPTGSVEWNAKSAAPGGSVWHGQSTQDFTDVDVAAT
FT                   DARLRARLRWCDRSVELPAGRYETLLPPSAVADLMVYLYWSAAGRDAAEGRTVFSRAGG
FT                   GTRVGEALGPAGLRLWSDPSAAGLTSAPFVTAGASSATSSVFDNGLPLGPTDWIRDGRL
FT                   NALVQTRSSARAASLAAPAAAPNSTSNSSGNGISAGAAGLAGQGIAVTPFVDNLLLDGG
FT                   GTATLDEMITSTRRGLLLTCLWYIREVDPQVLLLTGLTRDGVFLIENGEVVGAVNNFRF
FT                   NESPVDLLGRIAEIGASTRTMPREWADWFTLARMPALRIPDFNMSSVSPAS"
     MSEGLLVTGT TQAIRASHEI LERALELSRA DGAIVIASES STVNLRWANN TLTTNGAARD        60
     RSVTIISVIG RSFGVRSTST VDGPGVGADL AGLEALVRAS EAAARESDDA EDYSDLVVPA       120
     AAAVGGRSFT DPAERTSSEV FASFADDLAE AFGAARAEGR RLFGFAEHDR TTTWLGTSTG       180
     LRLRHSQPTG SVEWNAKSAA PGGSVWHGQS TQDFTDVDVA ATDARLRARL RWCDRSVELP       240
     AGRYETLLPP SAVADLMVYL YWSAAGRDAA EGRTVFSRAG GGTRVGEALG PAGLRLWSDP       300
     SAAGLTSAPF VTAGASSATS SVFDNGLPLG PTDWIRDGRL NALVQTRSSA RAASLAAPAA       360
     APNSTSNSSG NGISAGAAGL AGQGIAVTPF VDNLLLDGGG TATLDEMITS TRRGLLLTCL       420
     WYIREVDPQV LLLTGLTRDG VFLIENGEVV GAVNNFRFNE SPVDLLGRIA EIGASTRTMP       480
     REWADWFTLA RMPALRIPDF NMSSVSPAS                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page