(data stored in ACNUC7421 zone)

EMBL: CP000820.PE287

CP000820.PE287       Location/Qualifiers
FT   CDS             complement(341569..342840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09756"
FT                   /db_xref="GOA:A8LDZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ1"
FT                   /protein_id="ABW09756.1"
FT                   /translation="MTQGCGRCEMTALTSIEPGTEIPVGDLVVIGVALTVVAACLGRLR
FT                   AAFILGIPTLLLAGIATILGWLLGGTADSGNTVPPPARSLSPEATAGAAPGGGTHWGAF
FT                   FLTVLGAVLIILGTVVWAIWSKRHSERFELGNGAGSVPQPDPTALRWTHSDLPVSLSEL
FT                   DDDFYPDLPVQHQTPPDLNAWAPETAPADGRESTMGGPGQPRSRRNHQDQPTDPFFENI
FT                   AARIDRIVGLYLNAVTPRPGRPARVDLLAPDAQYFVSALTTTLDLFGGTAPADRMEPLV
FT                   EAVREVERRWDAVIGTRIGPNTPDETETARAPSAAPPRPAPGRPARDTKSTDEHADVPR
FT                   PTAASKHRLRIPPRPTPPPRPALPLVPGGTNSDGDRRRRRLPGEHPARNHRIRPELDRP
FT                   AEPDEPDGPSSPRESDRPDRPDRT"
     MTQGCGRCEM TALTSIEPGT EIPVGDLVVI GVALTVVAAC LGRLRAAFIL GIPTLLLAGI        60
     ATILGWLLGG TADSGNTVPP PARSLSPEAT AGAAPGGGTH WGAFFLTVLG AVLIILGTVV       120
     WAIWSKRHSE RFELGNGAGS VPQPDPTALR WTHSDLPVSL SELDDDFYPD LPVQHQTPPD       180
     LNAWAPETAP ADGRESTMGG PGQPRSRRNH QDQPTDPFFE NIAARIDRIV GLYLNAVTPR       240
     PGRPARVDLL APDAQYFVSA LTTTLDLFGG TAPADRMEPL VEAVREVERR WDAVIGTRIG       300
     PNTPDETETA RAPSAAPPRP APGRPARDTK STDEHADVPR PTAASKHRLR IPPRPTPPPR       360
     PALPLVPGGT NSDGDRRRRR LPGEHPARNH RIRPELDRPA EPDEPDGPSS PRESDRPDRP       420
     DRT                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page