(data stored in ACNUC7421 zone)

EMBL: CP000820.PE29

CP000820.PE29        Location/Qualifiers
FT   CDS             37862..38839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09498"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB37"
FT                   /protein_id="ABW09498.1"
FT                   /translation="MSGPAVPRRRPGSGGRVSDEHVWYLASRLTARDRWLLAMLAEHQI
FT                   LTTRQIALLCFSGDRTARARLALLAELRAVDRVRPLRGDLATPYHYTLGPAGAQVLAAQ
FT                   AALPVSEFYRRDRGLSLIYSRLLDHTVGANGLFVAFAHASRPRPANDGLVLWWSEKRAV
FT                   TMWRQWVRPDGFGAWYHQGRRLDFFVEFDTGTEPLTRVAGKIPGYAKLAVSSGMVSPVL
FT                   IWLPTPTREANLRRQLLITGGVVVITASPPPGTAPPELDNSREAVDLAAARPVWLPLGS
FT                   TTRADLDGLTLRFGRPAGPPGPSDEDEEQSAPPPRPPQPRRPRP"
     MSGPAVPRRR PGSGGRVSDE HVWYLASRLT ARDRWLLAML AEHQILTTRQ IALLCFSGDR        60
     TARARLALLA ELRAVDRVRP LRGDLATPYH YTLGPAGAQV LAAQAALPVS EFYRRDRGLS       120
     LIYSRLLDHT VGANGLFVAF AHASRPRPAN DGLVLWWSEK RAVTMWRQWV RPDGFGAWYH       180
     QGRRLDFFVE FDTGTEPLTR VAGKIPGYAK LAVSSGMVSP VLIWLPTPTR EANLRRQLLI       240
     TGGVVVITAS PPPGTAPPEL DNSREAVDLA AARPVWLPLG STTRADLDGL TLRFGRPAGP       300
     PGPSDEDEEQ SAPPPRPPQP RRPRP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page