(data stored in ACNUC7421 zone)

EMBL: CP000820.PE290

CP000820.PE290       Location/Qualifiers
FT   CDS             complement(345121..345927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0293"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: fal:FRAAL6592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09759"
FT                   /db_xref="GOA:A8LDZ4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ4"
FT                   /protein_id="ABW09759.1"
FT                   /translation="MVDWLLVSRPVLVATDLDGTLIRTDGTVSDRTRDALRQVENSGST
FT                   VVFVTGRPTRVMADVVRQTAVSGLAICANGALVYDLDTGVPVSQTILETPAALKLAAAI
FT                   RAAVPDATFAVESGVRFGREPDFLTMWPDPGELVAGFHELLEHLPATKLLVRRGGASLA
FT                   DVYETVVALAGTEAVVTTSSHDLIEIAGPGVSKAVALAELASERGVLAAEVVAFGDMPN
FT                   DLPMFAWAGHSVAVANAHPDVLAAADEITASNDDDGVAQVLERLFS"
     MVDWLLVSRP VLVATDLDGT LIRTDGTVSD RTRDALRQVE NSGSTVVFVT GRPTRVMADV        60
     VRQTAVSGLA ICANGALVYD LDTGVPVSQT ILETPAALKL AAAIRAAVPD ATFAVESGVR       120
     FGREPDFLTM WPDPGELVAG FHELLEHLPA TKLLVRRGGA SLADVYETVV ALAGTEAVVT       180
     TSSHDLIEIA GPGVSKAVAL AELASERGVL AAEVVAFGDM PNDLPMFAWA GHSVAVANAH       240
     PDVLAAADEI TASNDDDGVA QVLERLFS                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page