(data stored in ACNUC7421 zone)

EMBL: CP000820.PE292

CP000820.PE292       Location/Qualifiers
FT   CDS             346689..347537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0295"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: fal:FRAAL6590 ATP phosphoribosyltransferase
FT                   (ATP-PRTase) (ATP-PRT); TIGRFAM: ATP
FT                   phosphoribosyltransferase; PFAM: Histidine biosynthesis
FT                   protein HisG domain; ATP phosphoribosyltransferase
FT                   catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09761"
FT                   /db_xref="GOA:A8LDZ6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ6"
FT                   /protein_id="ABW09761.1"
FT                   /translation="MMLRIAVPNKGGLAAASSQLLCDAGYLARRESAELVVADVENDIE
FT                   FFFLRPRDIAVYVGTGRLDLGITGRDLLVDSNTSAQELVPLGFGQSAFHYAAPAGTMSD
FT                   IKELDGLRVATSFPGLVRTDLAGRGISVQIVKLDGAVETAVRLGVADAVADVVETGRTL
FT                   RAAGLELVGESVLRSEAIMIAKRGADLSAAHERLLRRVQGVLVARRYVMMDYDVPSSVL
FT                   EKACEVTPGYESPTISPLQREGWVAVRAMVLKADVNRTMDDLWDLGARGILVSGIQACR
FT                   L"
     MMLRIAVPNK GGLAAASSQL LCDAGYLARR ESAELVVADV ENDIEFFFLR PRDIAVYVGT        60
     GRLDLGITGR DLLVDSNTSA QELVPLGFGQ SAFHYAAPAG TMSDIKELDG LRVATSFPGL       120
     VRTDLAGRGI SVQIVKLDGA VETAVRLGVA DAVADVVETG RTLRAAGLEL VGESVLRSEA       180
     IMIAKRGADL SAAHERLLRR VQGVLVARRY VMMDYDVPSS VLEKACEVTP GYESPTISPL       240
     QREGWVAVRA MVLKADVNRT MDDLWDLGAR GILVSGIQAC RL                          282
//

If you have problems or comments...

PBIL Back to PBIL home page