(data stored in ACNUC7421 zone)

EMBL: CP000820.PE293

CP000820.PE293       Location/Qualifiers
FT   CDS             347677..349551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0296"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: cyclic nucleotide-binding; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; glutaminase;
FT                   KEGG: rha:RHA1_ro06842 probable glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09762"
FT                   /db_xref="GOA:A8LDZ7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ7"
FT                   /protein_id="ABW09762.1"
FT                   /translation="MRAGGNARPAKDSRLRAPDAGPMERMLADIHEAFRTDRSGKVASF
FT                   IPELATADPALFGLAVTTMDGLRYRAGDSDVPFTIQSVSKPFVYALALRDRGTDGVLAR
FT                   VGVEPTGDAFNAITLEPETGRPLNPMVNAGALLTSSLVGGGDAAERFDRVLTGLSAFAG
FT                   RQLTVNERVFASERDTGDRNRAIGYLMRGAGALRGPVDEICEVYFRQCAVEVTAADLAV
FT                   MAGTLARGGVNPLTGERVLNEEHVNHVLTVMATCGMYDRAGTWLFRVGLPAKSGVAGGV
FT                   CAVLPGQLGIGVFSPPLDEVGNSVRGVRACERLASRFALHLLAPQGEPPHPVRGTHRGD
FT                   ALSSKRMRGARERAVLAVRGSAIVIHELQGDLVFASAERVVRTVRQHLDDVRWVVLDLR
FT                   RVAAVREPALELLRVLLDELASRDVNVLFADPRGLPGVDRLMRGDWSTQRVPDLETALE
FT                   WAEEALLMREDLATLPPTAHVPLGAQELLTDLGKEGTRVIGAMCERRTYERGATVFDEG
FT                   DPADALYFVTRGLANAQAPNADGTRWFRLSSVPAGSAFGELALVDGGRRSTRIVVAETM
FT                   TCEVLSVAAFDTLVREHPDVYNALVRAIARSLSAQLRRATREIQSLEE"
     MRAGGNARPA KDSRLRAPDA GPMERMLADI HEAFRTDRSG KVASFIPELA TADPALFGLA        60
     VTTMDGLRYR AGDSDVPFTI QSVSKPFVYA LALRDRGTDG VLARVGVEPT GDAFNAITLE       120
     PETGRPLNPM VNAGALLTSS LVGGGDAAER FDRVLTGLSA FAGRQLTVNE RVFASERDTG       180
     DRNRAIGYLM RGAGALRGPV DEICEVYFRQ CAVEVTAADL AVMAGTLARG GVNPLTGERV       240
     LNEEHVNHVL TVMATCGMYD RAGTWLFRVG LPAKSGVAGG VCAVLPGQLG IGVFSPPLDE       300
     VGNSVRGVRA CERLASRFAL HLLAPQGEPP HPVRGTHRGD ALSSKRMRGA RERAVLAVRG       360
     SAIVIHELQG DLVFASAERV VRTVRQHLDD VRWVVLDLRR VAAVREPALE LLRVLLDELA       420
     SRDVNVLFAD PRGLPGVDRL MRGDWSTQRV PDLETALEWA EEALLMREDL ATLPPTAHVP       480
     LGAQELLTDL GKEGTRVIGA MCERRTYERG ATVFDEGDPA DALYFVTRGL ANAQAPNADG       540
     TRWFRLSSVP AGSAFGELAL VDGGRRSTRI VVAETMTCEV LSVAAFDTLV REHPDVYNAL       600
     VRAIARSLSA QLRRATREIQ SLEE                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page