(data stored in ACNUC7421 zone)

EMBL: CP000820.PE295

CP000820.PE295       Location/Qualifiers
FT   CDS             complement(350427..352688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0298"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: fal:FRAAL6588 cell division protein FtsH
FT                   (ATP-dependent zinc-metallo protease); TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   AAA ATPase central domain protein; peptidase M41 FtsH
FT                   extracellular; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09764"
FT                   /db_xref="GOA:A8LDZ9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ9"
FT                   /protein_id="ABW09764.1"
FT                   /translation="MTPRRIFRGWVPLLLLVLFVIILTTGVLSGPSEYQKADLSFVQQQ
FT                   IDQSAGAKPETRVVDATIQDSKQIIRIELGNGKKYESSFATEQALVLANELKQQNIKYN
FT                   VSVDRGNVLVSLLLNLLPVLLIVFLLLFFMNQMQGGGNRVMNFGKSKAKLVSKDTPKTT
FT                   FADVAGADEAIEELQEIKEFLENPGKFQAIGAKIPKGVLLYGPPGTGKTLLARAVAGEA
FT                   GVPFYSISGSDFVEMFVGVGASRVRDLFEQAKANAPAIIFVDEIDAVGRHRGAGLGGGH
FT                   DEREQTLNQLLVEMDGFDVKGGVILIAATNRPDILDPALLRPGRFDRQIVVDRPDLLGR
FT                   EAILKVHAKGKPISSDVDMLIIARRTPGFTGADLANVLNEAALLAARSDVRFISSALLE
FT                   ESIDRVMAGPERKTRAMSDREKKRIAYHEGGHALVAHALPNADPVHKITILPRGRALGY
FT                   TMQLPLEDKYLSTRSEMLDRLAVLLGGRTAEELVFHEPTTGASDDIEKATQIARAMITQ
FT                   YGMSDKLGAIKFGSESGEVFLGRDMGHQRDYSEEVASEIDDEVRRLIEAAHDEAWEILV
FT                   TYRDVLDNLVLRLMDTETLSKDDVLEVFATVQKRPSRGSYTGVGRRIPSDRPPVQTPAE
FT                   LGLVPSKVSDLVKGNSGPAGHATNGGGTNGGGSANGGGVSGGNGTAGHPRPAGQADPGT
FT                   AGGPAGLGHGDPAQSGPGHSASSPAHGTPPPGSPPPEGPRIANPWAPPTWDNDDDRRRR
FT                   "
     MTPRRIFRGW VPLLLLVLFV IILTTGVLSG PSEYQKADLS FVQQQIDQSA GAKPETRVVD        60
     ATIQDSKQII RIELGNGKKY ESSFATEQAL VLANELKQQN IKYNVSVDRG NVLVSLLLNL       120
     LPVLLIVFLL LFFMNQMQGG GNRVMNFGKS KAKLVSKDTP KTTFADVAGA DEAIEELQEI       180
     KEFLENPGKF QAIGAKIPKG VLLYGPPGTG KTLLARAVAG EAGVPFYSIS GSDFVEMFVG       240
     VGASRVRDLF EQAKANAPAI IFVDEIDAVG RHRGAGLGGG HDEREQTLNQ LLVEMDGFDV       300
     KGGVILIAAT NRPDILDPAL LRPGRFDRQI VVDRPDLLGR EAILKVHAKG KPISSDVDML       360
     IIARRTPGFT GADLANVLNE AALLAARSDV RFISSALLEE SIDRVMAGPE RKTRAMSDRE       420
     KKRIAYHEGG HALVAHALPN ADPVHKITIL PRGRALGYTM QLPLEDKYLS TRSEMLDRLA       480
     VLLGGRTAEE LVFHEPTTGA SDDIEKATQI ARAMITQYGM SDKLGAIKFG SESGEVFLGR       540
     DMGHQRDYSE EVASEIDDEV RRLIEAAHDE AWEILVTYRD VLDNLVLRLM DTETLSKDDV       600
     LEVFATVQKR PSRGSYTGVG RRIPSDRPPV QTPAELGLVP SKVSDLVKGN SGPAGHATNG       660
     GGTNGGGSAN GGGVSGGNGT AGHPRPAGQA DPGTAGGPAG LGHGDPAQSG PGHSASSPAH       720
     GTPPPGSPPP EGPRIANPWA PPTWDNDDDR RRR                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page