(data stored in ACNUC7421 zone)

EMBL: CP000820.PE297

CP000820.PE297       Location/Qualifiers
FT   CDS             complement(354886..356019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09766"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LE01"
FT                   /protein_id="ABW09766.1"
FT                   /translation="MDAELVDWELAVTTAKKLVRPGPQRSRAEADEIVSELRRLAVVAE
FT                   GHVQDYTQLVPAGPPTPIAVVDRPEWVRSNVAGLRVATMPLIEKLSDQSRGRLAAAVGR
FT                   RVTGVQVGSALAYLAGKVLGQFEVFLPPEEYEAGSAASAPSLAKPGAPTPVGRLSLVAP
FT                   NIAHAEETLRVVPRDFRLWVCLHEQTHRSQFTAVPWLREHLESEIAAFIGATDLDPDVL
FT                   ADRLRSAVTALRSAVRDHGPDTPSVVEALQTPAQRAVLDRLQALMSLLEGHADQVMDAV
FT                   GPQVVPTVADIRGKFDNRRSGGSPIDRFLRRLLGLDLKMQQYRQGGAFVRAVVAEVGVE
FT                   GFNHVWQSPRTLPTRPELTDPGAWMLRVLGTRPSMSA"
     MDAELVDWEL AVTTAKKLVR PGPQRSRAEA DEIVSELRRL AVVAEGHVQD YTQLVPAGPP        60
     TPIAVVDRPE WVRSNVAGLR VATMPLIEKL SDQSRGRLAA AVGRRVTGVQ VGSALAYLAG       120
     KVLGQFEVFL PPEEYEAGSA ASAPSLAKPG APTPVGRLSL VAPNIAHAEE TLRVVPRDFR       180
     LWVCLHEQTH RSQFTAVPWL REHLESEIAA FIGATDLDPD VLADRLRSAV TALRSAVRDH       240
     GPDTPSVVEA LQTPAQRAVL DRLQALMSLL EGHADQVMDA VGPQVVPTVA DIRGKFDNRR       300
     SGGSPIDRFL RRLLGLDLKM QQYRQGGAFV RAVVAEVGVE GFNHVWQSPR TLPTRPELTD       360
     PGAWMLRVLG TRPSMSA                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page