(data stored in ACNUC7421 zone)

EMBL: CP000820.PE3

CP000820.PE3         Location/Qualifiers
FT   CDS             3956..5116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: fal:FRAAL0004 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09472"
FT                   /db_xref="GOA:A8LB18"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB18"
FT                   /protein_id="ABW09472.1"
FT                   /translation="MRFRVERDEFTDAVAWTARTLPSRATTQLQVLAGLLLDATGPALK
FT                   VAAFDYEVAAQGELDATVTEEGRGLVNGKMLADITRSLPAAPVDVHVDGTRLVVACGNA
FT                   RFALPMLPVDDYPTLPPMPEITGHIEGAAFGSAVAQVAVAAGRDDTLPVLTGVRLEIDG
FT                   DTLTLAATDRYRLAVRTLKWRPATPDASGVALVPARTLLDTAKSLSGSGVEVAVALGTG
FT                   PSGETLAGFAGNTRQTTTRLLEGTFPPYRKLLPDSSPLIAQLEIAPLTEAVKRVALVAA
FT                   RTAPVQLTFTPDHLVLEAGTGGEAQASETLPVTYDGPELTVAFNPAYLLDALGALESDI
FT                   VRIGFASAEDAALAASKPAILTGKGGDDQTEIPDYRYLLMPIRLNG"
     MRFRVERDEF TDAVAWTART LPSRATTQLQ VLAGLLLDAT GPALKVAAFD YEVAAQGELD        60
     ATVTEEGRGL VNGKMLADIT RSLPAAPVDV HVDGTRLVVA CGNARFALPM LPVDDYPTLP       120
     PMPEITGHIE GAAFGSAVAQ VAVAAGRDDT LPVLTGVRLE IDGDTLTLAA TDRYRLAVRT       180
     LKWRPATPDA SGVALVPART LLDTAKSLSG SGVEVAVALG TGPSGETLAG FAGNTRQTTT       240
     RLLEGTFPPY RKLLPDSSPL IAQLEIAPLT EAVKRVALVA ARTAPVQLTF TPDHLVLEAG       300
     TGGEAQASET LPVTYDGPEL TVAFNPAYLL DALGALESDI VRIGFASAED AALAASKPAI       360
     LTGKGGDDQT EIPDYRYLLM PIRLNG                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page