(data stored in ACNUC7421 zone)

EMBL: CP000820.PE300

CP000820.PE300       Location/Qualifiers
FT   CDS             359498..360229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0303"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: fal:FRAAL6583 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09769"
FT                   /db_xref="GOA:A8LF24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF24"
FT                   /protein_id="ABW09769.1"
FT                   /translation="MTGAGEGAPGTTRGASLLVAEDDEASRIALARSLERFGYRVLEAA
FT                   DGEAALRLFQTTEIDLVVLDVAMPRMDGFAVLSRLRQTSEVPVIMLTGRAEEVDRVVGL
FT                   ELGADDYVVKPYSLRELVARVRARLRRRPVEAPPQRTGDGNEPLIYGDVSIDLRAREVA
FT                   VAGERVDLTAREYELLAFLARHPRRVFSREELLEQVWGTRFQDPATVTEHVRRVRTKVE
FT                   GRPPQRRLVTTLRGMGYRFDP"
     MTGAGEGAPG TTRGASLLVA EDDEASRIAL ARSLERFGYR VLEAADGEAA LRLFQTTEID        60
     LVVLDVAMPR MDGFAVLSRL RQTSEVPVIM LTGRAEEVDR VVGLELGADD YVVKPYSLRE       120
     LVARVRARLR RRPVEAPPQR TGDGNEPLIY GDVSIDLRAR EVAVAGERVD LTAREYELLA       180
     FLARHPRRVF SREELLEQVW GTRFQDPATV TEHVRRVRTK VEGRPPQRRL VTTLRGMGYR       240
     FDP                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page