(data stored in ACNUC7421 zone)

EMBL: CP000820.PE302

CP000820.PE302       Location/Qualifiers
FT   CDS             complement(360969..362006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0305"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: fal:FRAAL6582
FT                   hypothetical protein; putative signal peptidase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09771"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF26"
FT                   /protein_id="ABW09771.1"
FT                   /translation="MPMMCAVSFSRRGRLYYADPGPYSPRVGDRVLVPTDEGPEVATCV
FT                   WAPQWVSEDVGGLPVLAGLADEDDLRRDDAARRRRAQARVAARRLVREHGLPMKVVGVD
FT                   VVPDSNAFTVYFTAENRVDFRALVRDLNRTLSARVQLRQLSARDSAKLQGGIGSCGRDL
FT                   CCSTFLTDFEPVSVRMAKDQNLSLNPMRISGACGRLMCCLRYEHPLYEEFTAAVPAVGA
FT                   RASTPDGDGRVVAHDVPRQQVTVALDGGGRHACSRADVCGSRKAYEATHAAGPAAPAGT
FT                   AEAAGMAGPADMAGPAATAEPTGTAEPAGPAGTAGPAPDGGEDGSPDTAGGRSHRRRSR
FT                   RRTEH"
     MPMMCAVSFS RRGRLYYADP GPYSPRVGDR VLVPTDEGPE VATCVWAPQW VSEDVGGLPV        60
     LAGLADEDDL RRDDAARRRR AQARVAARRL VREHGLPMKV VGVDVVPDSN AFTVYFTAEN       120
     RVDFRALVRD LNRTLSARVQ LRQLSARDSA KLQGGIGSCG RDLCCSTFLT DFEPVSVRMA       180
     KDQNLSLNPM RISGACGRLM CCLRYEHPLY EEFTAAVPAV GARASTPDGD GRVVAHDVPR       240
     QQVTVALDGG GRHACSRADV CGSRKAYEAT HAAGPAAPAG TAEAAGMAGP ADMAGPAATA       300
     EPTGTAEPAG PAGTAGPAPD GGEDGSPDTA GGRSHRRRSR RRTEH                       345
//

If you have problems or comments...

PBIL Back to PBIL home page