(data stored in ACNUC7421 zone)

EMBL: CP000820.PE303

CP000820.PE303       Location/Qualifiers
FT   CDS             complement(362170..363108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0306"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sco:SCO7376
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09772"
FT                   /db_xref="GOA:A8LF27"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF27"
FT                   /protein_id="ABW09772.1"
FT                   /translation="MRVAAVGDLHVVPGSAFRLRPLYQRAAIVADVLLLAGDLTNDGEL
FT                   DSAAELCTVVRGLDLPVVAVLGNHDHDAGEGPRVAAMLGDAGAIVLDGTAATIGTAAGP
FT                   VGVAGVTGFADNHLADGGPGGRTPEDAAADAFHLCDALASLDTDVRIALTHYAPVRETL
FT                   TGEAPGLHRFLGSSLLGAAIDGSRAAGAGRGTGPGRGATAARRSGMAGTGATAGTLDPP
FT                   GPASVFPSDGPAPAPADGSWHGSVTPGSVTPGCGAGALDAPATALAVHGHAHHGQETGR
FT                   TPGGTPVRNVARPVIVAPFAVYQVPGGARIG"
     MRVAAVGDLH VVPGSAFRLR PLYQRAAIVA DVLLLAGDLT NDGELDSAAE LCTVVRGLDL        60
     PVVAVLGNHD HDAGEGPRVA AMLGDAGAIV LDGTAATIGT AAGPVGVAGV TGFADNHLAD       120
     GGPGGRTPED AAADAFHLCD ALASLDTDVR IALTHYAPVR ETLTGEAPGL HRFLGSSLLG       180
     AAIDGSRAAG AGRGTGPGRG ATAARRSGMA GTGATAGTLD PPGPASVFPS DGPAPAPADG       240
     SWHGSVTPGS VTPGCGAGAL DAPATALAVH GHAHHGQETG RTPGGTPVRN VARPVIVAPF       300
     AVYQVPGGAR IG                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page