(data stored in ACNUC7421 zone)

EMBL: CP000820.PE308

CP000820.PE308       Location/Qualifiers
FT   CDS             complement(373694..374212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0311"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: fal:FRAAL6575 putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09777"
FT                   /db_xref="GOA:A8LF32"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF32"
FT                   /protein_id="ABW09777.1"
FT                   /translation="MPTVELHFAALPGHVRTARMIATAVSRRAGVPAGAVDEIKLAVGE
FT                   ACARAVRVNRRSNPEALVHVALTDAPETFTVIVSDSGAPGDEVAPGPDGGLISAPALLD
FT                   LGGADLGGAAALGSAALTAPGLDGDPDADQPFPPGLGLALIEGLVDEVAVRRGTGRHGH
FT                   RRRDDLAHR"
     MPTVELHFAA LPGHVRTARM IATAVSRRAG VPAGAVDEIK LAVGEACARA VRVNRRSNPE        60
     ALVHVALTDA PETFTVIVSD SGAPGDEVAP GPDGGLISAP ALLDLGGADL GGAAALGSAA       120
     LTAPGLDGDP DADQPFPPGL GLALIEGLVD EVAVRRGTGR HGHRRRDDLA HR               172
//

If you have problems or comments...

PBIL Back to PBIL home page