(data stored in ACNUC7421 zone)

EMBL: CP000820.PE313

CP000820.PE313       Location/Qualifiers
FT   CDS             complement(379368..379640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09782"
FT                   /db_xref="GOA:A8LF37"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF37"
FT                   /protein_id="ABW09782.1"
FT                   /translation="MSPEATMLFLYALLRPRRSVPSPRPRHRRWYRSPRSNAGVPTDAG
FT                   MSTAEYAVGTLAAVAFAGVLYAVISSSATRSLISSVVQRALTVAF"
     MSPEATMLFL YALLRPRRSV PSPRPRHRRW YRSPRSNAGV PTDAGMSTAE YAVGTLAAVA        60
     FAGVLYAVIS SSATRSLISS VVQRALTVAF                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page