(data stored in ACNUC7421 zone)

EMBL: CP000820.PE32

CP000820.PE32        Location/Qualifiers
FT   CDS             complement(42120..42485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09501"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB40"
FT                   /protein_id="ABW09501.1"
FT                   /translation="MVGCAVRMTPRSPLVPVALRPVVLIARMAALPELTPPEDIARILA
FT                   TFTPPIDPASPEWAALRTALDRYDAAHDQAAFDAARRQIVLAAVTLLLGPPGYSAPDTP
FT                   ARCRVPAQRTPPPSRRT"
     MVGCAVRMTP RSPLVPVALR PVVLIARMAA LPELTPPEDI ARILATFTPP IDPASPEWAA        60
     LRTALDRYDA AHDQAAFDAA RRQIVLAAVT LLLGPPGYSA PDTPARCRVP AQRTPPPSRR       120
     T                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page