(data stored in ACNUC7421 zone)

EMBL: CP000820.PE320

CP000820.PE320       Location/Qualifiers
FT   CDS             complement(387501..388682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0323"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; Colicin
FT                   V production protein; KEGG: fal:FRAAL6561 serine
FT                   proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09789"
FT                   /db_xref="GOA:A8LF44"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF44"
FT                   /protein_id="ABW09789.1"
FT                   /translation="MNLLDLVLIVLVVMFAVSGYRQGFAVGALSFVGFLGGGVLGAKVA
FT                   RPFAELIGREEDGALVGLIVVVGLALVGQIAGTALGAALRGRLTWRPGQRLDAVAGAVL
FT                   SGMSVLLVAWLVATAVDRSPFQTLARAARGSEVLGTVDTTMPDDVRHTFADLRRLMDDQ
FT                   GFPEVFAGLDGERIVATDPPDPAVVSAADVQNAAASILKVRGQAPSCGKQVEGTGFVIA
FT                   PQRVMTNAHVVAGVTEAVVELDSGSLPAEVVLFDPDRDVAVLHVPGLLRPPLRFQSAPP
FT                   GDMGDSAVVAGYPQDGPYTTVPARIRNEQVARAPDIYSRGTVRREIYAIRGRVRPGNSG
FT                   GPLLSSAGTVYGVVFAAATDDNDTGYVLTADEVSEPARQGAQALVPVSTQSCD"
     MNLLDLVLIV LVVMFAVSGY RQGFAVGALS FVGFLGGGVL GAKVARPFAE LIGREEDGAL        60
     VGLIVVVGLA LVGQIAGTAL GAALRGRLTW RPGQRLDAVA GAVLSGMSVL LVAWLVATAV       120
     DRSPFQTLAR AARGSEVLGT VDTTMPDDVR HTFADLRRLM DDQGFPEVFA GLDGERIVAT       180
     DPPDPAVVSA ADVQNAAASI LKVRGQAPSC GKQVEGTGFV IAPQRVMTNA HVVAGVTEAV       240
     VELDSGSLPA EVVLFDPDRD VAVLHVPGLL RPPLRFQSAP PGDMGDSAVV AGYPQDGPYT       300
     TVPARIRNEQ VARAPDIYSR GTVRREIYAI RGRVRPGNSG GPLLSSAGTV YGVVFAAATD       360
     DNDTGYVLTA DEVSEPARQG AQALVPVSTQ SCD                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page