(data stored in ACNUC7421 zone)

EMBL: CP000820.PE321

CP000820.PE321       Location/Qualifiers
FT   CDS             complement(388702..389118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0324"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   fal:FRAAL6560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09790"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF45"
FT                   /protein_id="ABW09790.1"
FT                   /translation="MTSRSARSALVALATAVAVLTALTGCGSGGGDAGTPSAAATLTPS
FT                   VSDGTQVFAVVGQVDQTFSARELVAHPGTIRVDFSVAKGSAPHNFVISAIPGATTRIVS
FT                   AGNSQSITFTADKPGRYPVVCTLHQGMTATLVIV"
     MTSRSARSAL VALATAVAVL TALTGCGSGG GDAGTPSAAA TLTPSVSDGT QVFAVVGQVD        60
     QTFSARELVA HPGTIRVDFS VAKGSAPHNF VISAIPGATT RIVSAGNSQS ITFTADKPGR       120
     YPVVCTLHQG MTATLVIV                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page