(data stored in ACNUC7421 zone)

EMBL: CP000820.PE325

CP000820.PE325       Location/Qualifiers
FT   CDS             391269..392009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0328"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein Crp; KEGG: fal:FRAAL6556 putative Crp/Fnr-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09794"
FT                   /db_xref="GOA:A8LF49"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF49"
FT                   /protein_id="ABW09794.1"
FT                   /translation="MGVPGRALRPVSWHAQGVDDLLARVPLFAGLSEPDRQALSDHLDR
FT                   QDVTRGDVLFREGDVGDRVFVVLSGKVKIGRQSADGRENLLYVMGPGDLFGELSLFDPG
FT                   PRTATATAVTDASLVALEHTALRPWLRSRPEAGALLLRVLARRLRRTNDTMADMVFTDV
FT                   PGRVAKALLDLADRFGEPAQPGNEAAGVRVEHGLTQEELAQLVGASRETVNKALADFAT
FT                   RGWLRLDSRAVVLLDRERLARRAR"
     MGVPGRALRP VSWHAQGVDD LLARVPLFAG LSEPDRQALS DHLDRQDVTR GDVLFREGDV        60
     GDRVFVVLSG KVKIGRQSAD GRENLLYVMG PGDLFGELSL FDPGPRTATA TAVTDASLVA       120
     LEHTALRPWL RSRPEAGALL LRVLARRLRR TNDTMADMVF TDVPGRVAKA LLDLADRFGE       180
     PAQPGNEAAG VRVEHGLTQE ELAQLVGASR ETVNKALADF ATRGWLRLDS RAVVLLDRER       240
     LARRAR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page