(data stored in ACNUC7421 zone)

EMBL: CP000820.PE326

CP000820.PE326       Location/Qualifiers
FT   CDS             complement(392138..395995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0329"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: fal:FRAAL6555
FT                   putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09795"
FT                   /db_xref="GOA:A8LF50"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF50"
FT                   /protein_id="ABW09795.1"
FT                   /translation="MVISSPTTGPLVCPRCGTPTVPGGRFCFNCGLRFTQTDTPRAEAA
FT                   ERRVVTVLFGDLSDFTAWAEDRDPERVGEVTDRVLAALAREVDEVGGRVDNLSGDGIMA
FT                   VFGAPTAHEDDPERAVRAAAAMQETARRLIKDEGGDSSPLGLRVGVNTGEVLAGVQAAL
FT                   SYTVIGDTVNTAARLSGAAAVGTVYAGRDTVTATRSVATWRDLPPLVLKGKREPVPAYE
FT                   LVSLRPSNIARPGLADDATFIGREQELAELSRYFAGVVDAGQPDMAVVIGEAGIGKTRL
FT                   ARELAETAEATAGATVLWGRTVRHGDVRDLAPLIDLIRGACGITDGDTLDRVADRVRRT
FT                   VAGLTHPIFETKLPSGIGDRLLGMLGVPPDRRPSAGATTPPGDPVGRASHGEAVQRAAD
FT                   DAVETVGLLLSALAVRNPVLVVVDDLEWATSRLTTALRRLTTTLSGPVMLVLLDRESPQ
FT                   FSDLVGARRIALSPLPESAARALLKDYLGEPGLSRATQAELLARVHGNPFFLTELLNLL
FT                   VDRGLLHQVPDPGGEGMRWVLEGSLAATVLPAGVQSVLAARIDDLDAAAKAALRAAAVL
FT                   GPRFPAEALQVVGERPAAEVERALSVLTERQLVRPPRQGETLWRFVHPMARDVAYSGLP
FT                   KVERARRHATAARWGVTAMIGSSREVSTFVATHALRAYDLAASMALPAGDPAWSAREAG
FT                   FHAHVRLARSALARDDHRAAADLLADARRLGRGVIDGDDDINVRILHAEALVWLRRLDE
FT                   AERTLRPALRVNVPSRRAAAYAVLGELRQKQGRGEEARQSLITALEAAHRAGDDRAVAA
FT                   ALRRLGLLEYAAGRIQAAEERYREALSLARRVDDPRGVGWALQHLAWSATTRGDYAKAE
FT                   RTLREASAVFERLEDAGGLGWCSGTEALVLLLSGQLTRTRKVSRVLINLAESMRERWGQ
FT                   AVCLTIDAVAAAELGDIETAESEAARAAELFTETGDSWGRTLTLIARGLAARGAGRPRR
FT                   GADLLTEACAEAASTGHVLIGAFAQVLLGLTRLDAGEVDAAEEAARRALADLDRLELRP
FT                   HAQLGAKVLVAQIARARGRLDEAITELRGALSASEPATLMFPRRQAYAHLAGTLLDAGE
FT                   PDEALRVARQAVGVDAEDVRAQVLAYRALGTVLAAHGDVEGSREAYEQALAAATATGAI
FT                   SEAPQTRRLLAALPGSAPDALDAPDGLDAADGLGAADGLGVADGLGTPHQDGLAAQDDL
FT                   SAQDGLGAAAALAKVSVNGTRARARTAARLPGSPVVVPVADPSGEAVPSVEMPPAEGTS
FT                   R"
     MVISSPTTGP LVCPRCGTPT VPGGRFCFNC GLRFTQTDTP RAEAAERRVV TVLFGDLSDF        60
     TAWAEDRDPE RVGEVTDRVL AALAREVDEV GGRVDNLSGD GIMAVFGAPT AHEDDPERAV       120
     RAAAAMQETA RRLIKDEGGD SSPLGLRVGV NTGEVLAGVQ AALSYTVIGD TVNTAARLSG       180
     AAAVGTVYAG RDTVTATRSV ATWRDLPPLV LKGKREPVPA YELVSLRPSN IARPGLADDA       240
     TFIGREQELA ELSRYFAGVV DAGQPDMAVV IGEAGIGKTR LARELAETAE ATAGATVLWG       300
     RTVRHGDVRD LAPLIDLIRG ACGITDGDTL DRVADRVRRT VAGLTHPIFE TKLPSGIGDR       360
     LLGMLGVPPD RRPSAGATTP PGDPVGRASH GEAVQRAADD AVETVGLLLS ALAVRNPVLV       420
     VVDDLEWATS RLTTALRRLT TTLSGPVMLV LLDRESPQFS DLVGARRIAL SPLPESAARA       480
     LLKDYLGEPG LSRATQAELL ARVHGNPFFL TELLNLLVDR GLLHQVPDPG GEGMRWVLEG       540
     SLAATVLPAG VQSVLAARID DLDAAAKAAL RAAAVLGPRF PAEALQVVGE RPAAEVERAL       600
     SVLTERQLVR PPRQGETLWR FVHPMARDVA YSGLPKVERA RRHATAARWG VTAMIGSSRE       660
     VSTFVATHAL RAYDLAASMA LPAGDPAWSA REAGFHAHVR LARSALARDD HRAAADLLAD       720
     ARRLGRGVID GDDDINVRIL HAEALVWLRR LDEAERTLRP ALRVNVPSRR AAAYAVLGEL       780
     RQKQGRGEEA RQSLITALEA AHRAGDDRAV AAALRRLGLL EYAAGRIQAA EERYREALSL       840
     ARRVDDPRGV GWALQHLAWS ATTRGDYAKA ERTLREASAV FERLEDAGGL GWCSGTEALV       900
     LLLSGQLTRT RKVSRVLINL AESMRERWGQ AVCLTIDAVA AAELGDIETA ESEAARAAEL       960
     FTETGDSWGR TLTLIARGLA ARGAGRPRRG ADLLTEACAE AASTGHVLIG AFAQVLLGLT      1020
     RLDAGEVDAA EEAARRALAD LDRLELRPHA QLGAKVLVAQ IARARGRLDE AITELRGALS      1080
     ASEPATLMFP RRQAYAHLAG TLLDAGEPDE ALRVARQAVG VDAEDVRAQV LAYRALGTVL      1140
     AAHGDVEGSR EAYEQALAAA TATGAISEAP QTRRLLAALP GSAPDALDAP DGLDAADGLG      1200
     AADGLGVADG LGTPHQDGLA AQDDLSAQDG LGAAAALAKV SVNGTRARAR TAARLPGSPV      1260
     VVPVADPSGE AVPSVEMPPA EGTSR                                            1285
//

If you have problems or comments...

PBIL Back to PBIL home page