(data stored in ACNUC7421 zone)

EMBL: CP000820.PE329

CP000820.PE329       Location/Qualifiers
FT   CDS             complement(398391..398882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0332"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: fal:FRAAL6552
FT                   putative translation initiation inhibitor; putative signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09798"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF53"
FT                   /protein_id="ABW09798.1"
FT                   /translation="MTAPVPPAAATTPSGRLAELGLVLPAVPTPAGAYVPAVRDGDLVW
FT                   TAGQLPLVAGKLLASGLVGAEITAERAAELARVCALNALAAAAAAVGGLDTITRIVKVV
FT                   GFVASAPGFVGQPVVLNGASELLGAVFGAAGLHARSAVGVAALPLGAPVEVELVARVAG
FT                   "
     MTAPVPPAAA TTPSGRLAEL GLVLPAVPTP AGAYVPAVRD GDLVWTAGQL PLVAGKLLAS        60
     GLVGAEITAE RAAELARVCA LNALAAAAAA VGGLDTITRI VKVVGFVASA PGFVGQPVVL       120
     NGASELLGAV FGAAGLHARS AVGVAALPLG APVEVELVAR VAG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page