(data stored in ACNUC7421 zone)

EMBL: CP000820.PE33

CP000820.PE33        Location/Qualifiers
FT   CDS             complement(42461..43171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6353 putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09502"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB41"
FT                   /protein_id="ABW09502.1"
FT                   /translation="MTGSISAVIRVAVARFPPTTAAVPDLRASTVRTLTRWSVDPDAVD
FT                   VAEVVVCELASNAVKASGPDDVVALRLTICDAVLTIEMWDASTAPPVLTVAHPDQESGR
FT                   GLVLVDAVSLRWAWYRSRTGGKVTWAQLPAATTPAVPTDSTAALPTRAATPVPAPAAPV
FT                   TFHDDPATLRRVIDRLRALDDWHRPPPGRGVRDRTPGGQTPKVPDQFVSPLDVEIIGYF
FT                   SPGISRTWSAAQSA"
     MTGSISAVIR VAVARFPPTT AAVPDLRAST VRTLTRWSVD PDAVDVAEVV VCELASNAVK        60
     ASGPDDVVAL RLTICDAVLT IEMWDASTAP PVLTVAHPDQ ESGRGLVLVD AVSLRWAWYR       120
     SRTGGKVTWA QLPAATTPAV PTDSTAALPT RAATPVPAPA APVTFHDDPA TLRRVIDRLR       180
     ALDDWHRPPP GRGVRDRTPG GQTPKVPDQF VSPLDVEIIG YFSPGISRTW SAAQSA           236
//

If you have problems or comments...

PBIL Back to PBIL home page