(data stored in ACNUC7421 zone)

EMBL: CP000820.PE337

CP000820.PE337       Location/Qualifiers
FT   CDS             408054..408719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0340"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: fal:FRAAL0823 putative two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09806"
FT                   /db_xref="GOA:A8LF61"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF61"
FT                   /protein_id="ABW09806.1"
FT                   /translation="MRVTPTRVVLADDAPLFRQAIAWLLEQHDFQVVGQVSDADGLRNA
FT                   VSALRPDIAVIDIRMPPTGRLEGLESAVELRARHPDLGVLLLSHYLESHYLPVLFGANA
FT                   RGVGYLLKERVTGIEAFVEAVTRVAAGGCVLDPEVVDLMIAARSRRDPLHTLTAREREV
FT                   LALMAEGRSNQAIGAQLVLTPKTVESHVRSIFTRLGLAPEPDDHRRVLAVLTYLRAHH"
     MRVTPTRVVL ADDAPLFRQA IAWLLEQHDF QVVGQVSDAD GLRNAVSALR PDIAVIDIRM        60
     PPTGRLEGLE SAVELRARHP DLGVLLLSHY LESHYLPVLF GANARGVGYL LKERVTGIEA       120
     FVEAVTRVAA GGCVLDPEVV DLMIAARSRR DPLHTLTARE REVLALMAEG RSNQAIGAQL       180
     VLTPKTVESH VRSIFTRLGL APEPDDHRRV LAVLTYLRAH H                           221
//

If you have problems or comments...

PBIL Back to PBIL home page