(data stored in ACNUC7421 zone)

EMBL: CP000820.PE340

CP000820.PE340       Location/Qualifiers
FT   CDS             411963..412901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0343"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rxy:Rxyl_0351 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09809"
FT                   /db_xref="GOA:A8LF64"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF64"
FT                   /protein_id="ABW09809.1"
FT                   /translation="MKAVRAGNGGVSVVDLEEPPGSGEVLKIAAASICSSDLLYIRLGS
FT                   QRIIGHELAGVREDGSAAIVEAIMGCTVCDLCRQGRYNLCVQHTKQALGATADGGIAEQ
FT                   FRVPSERLVPLPAGLDVRDAPLVEPASVSWHALRLAGTGPNTRVAVVGAGALGLLAVAG
FT                   ARHQGAPEVALDARHPHQAEAGERLGATLAHDGLYDVVVEAAGSTSGLDRAIDLVAPGG
FT                   TVVCVGVQLESKVGVNWSPLFHREGRLIPSMGYCAHENGREMEDAAAMLAKDPEITRTL
FT                   ITHRFPIADAAEAFRVAADRKAGALRVVIEP"
     MKAVRAGNGG VSVVDLEEPP GSGEVLKIAA ASICSSDLLY IRLGSQRIIG HELAGVREDG        60
     SAAIVEAIMG CTVCDLCRQG RYNLCVQHTK QALGATADGG IAEQFRVPSE RLVPLPAGLD       120
     VRDAPLVEPA SVSWHALRLA GTGPNTRVAV VGAGALGLLA VAGARHQGAP EVALDARHPH       180
     QAEAGERLGA TLAHDGLYDV VVEAAGSTSG LDRAIDLVAP GGTVVCVGVQ LESKVGVNWS       240
     PLFHREGRLI PSMGYCAHEN GREMEDAAAM LAKDPEITRT LITHRFPIAD AAEAFRVAAD       300
     RKAGALRVVI EP                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page