(data stored in ACNUC7421 zone)

EMBL: CP000820.PE344

CP000820.PE344       Location/Qualifiers
FT   CDS             complement(416191..416526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09813"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF68"
FT                   /protein_id="ABW09813.1"
FT                   /translation="MEIHGDPWISGPAGPGLLHCQTVDSEFGVSRITTRNTTWRSGRDR
FT                   DVSGSTGPPARPARPGTRRRKEVEMRTGSEAAGTTRGGRRSGVHLGTLTVTTSESSKMI
FT                   DINEERL"
     MEIHGDPWIS GPAGPGLLHC QTVDSEFGVS RITTRNTTWR SGRDRDVSGS TGPPARPARP        60
     GTRRRKEVEM RTGSEAAGTT RGGRRSGVHL GTLTVTTSES SKMIDINEER L                111
//

If you have problems or comments...

PBIL Back to PBIL home page