(data stored in ACNUC7421 zone)

EMBL: CP000820.PE349

CP000820.PE349       Location/Qualifiers
FT   CDS             420297..421421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0352"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: fal:FRAAL6535
FT                   high-affinity phosphate transport protein (ABC
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09818"
FT                   /db_xref="GOA:A8LF73"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF73"
FT                   /protein_id="ABW09818.1"
FT                   /translation="MDEGLLVNLGKRQIVAGLAAAALLSLAACGSDDNTDTADGTAPTA
FT                   SAGAIDCAKGSITGSGSSAQKNAMDEWVSAYQDACDGATINYQGSGSSTGRQQFIDKQV
FT                   TFAGSDSALKDAQKTAADARCTGGAAVDIPMVVGPISLIYNLDGVDKLNLSPSAIAKIF
FT                   SGAITKWNDPAIAADNSGVSLPDAPIQAVHRSDGSGTTDNFTKFLKGAAASDWTFEGGS
FT                   DWTAPGGQGAKGSDGVTSTVKSTPNAIGYVELSYAENASLPTALVGNASDEFIAASTDA
FT                   ASIGISSAKVADGDDLKLTFDYTTATKGAYPIYLATYEIVCTAGTPADQAPLLKSFLTY
FT                   IASADGQAAIGDLGYAPLPDEIATKVRGVIAKIA"
     MDEGLLVNLG KRQIVAGLAA AALLSLAACG SDDNTDTADG TAPTASAGAI DCAKGSITGS        60
     GSSAQKNAMD EWVSAYQDAC DGATINYQGS GSSTGRQQFI DKQVTFAGSD SALKDAQKTA       120
     ADARCTGGAA VDIPMVVGPI SLIYNLDGVD KLNLSPSAIA KIFSGAITKW NDPAIAADNS       180
     GVSLPDAPIQ AVHRSDGSGT TDNFTKFLKG AAASDWTFEG GSDWTAPGGQ GAKGSDGVTS       240
     TVKSTPNAIG YVELSYAENA SLPTALVGNA SDEFIAASTD AASIGISSAK VADGDDLKLT       300
     FDYTTATKGA YPIYLATYEI VCTAGTPADQ APLLKSFLTY IASADGQAAI GDLGYAPLPD       360
     EIATKVRGVI AKIA                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page