(data stored in ACNUC7421 zone)

EMBL: CP000820.PE35

CP000820.PE35        Location/Qualifiers
FT   CDS             43699..44568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0036"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   fal:FRAAL0518 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09504"
FT                   /db_xref="GOA:A8LB43"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB43"
FT                   /protein_id="ABW09504.1"
FT                   /translation="MPSTPGPTVRRRCLGAELRRLREAKELTVDQAGEHIHRSGPTISR
FT                   METGQFRFVLRNVSDLLDLYGVTDDEQRQALLALVKENRRPAWWHSYGDLVPRWFQVYI
FT                   GLEAEASTITTFESLLVPGLLQTEDYARAVIRAASPELPAHEVDRAVEVRMNRQKILTG
FT                   DQPVQLWAILDEAVIRRHVGNPTVMARQLDRLIEAAEQPAVTIQVVPFTAGAHAGMIAS
FT                   FTILGFPDTGGASETVYIEAPTGSLYLEKQAEVRRYEAWMNQLRSSALAPTPNTLSIIK
FT                   AAREDLQR"
     MPSTPGPTVR RRCLGAELRR LREAKELTVD QAGEHIHRSG PTISRMETGQ FRFVLRNVSD        60
     LLDLYGVTDD EQRQALLALV KENRRPAWWH SYGDLVPRWF QVYIGLEAEA STITTFESLL       120
     VPGLLQTEDY ARAVIRAASP ELPAHEVDRA VEVRMNRQKI LTGDQPVQLW AILDEAVIRR       180
     HVGNPTVMAR QLDRLIEAAE QPAVTIQVVP FTAGAHAGMI ASFTILGFPD TGGASETVYI       240
     EAPTGSLYLE KQAEVRRYEA WMNQLRSSAL APTPNTLSII KAAREDLQR                   289
//

If you have problems or comments...

PBIL Back to PBIL home page