(data stored in ACNUC7421 zone)

EMBL: CP000820.PE351

CP000820.PE351       Location/Qualifiers
FT   CDS             422738..423802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0354"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: fal:FRAAL6533
FT                   phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09820"
FT                   /db_xref="GOA:A8LF75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF75"
FT                   /protein_id="ABW09820.1"
FT                   /translation="MSTATTAPPAPVSGGSLNLRGQTLSRPVLGAIAVGAVVLTLLLYL
FT                   VTSIHSRIQFVLIALILFGIGQTVASVVVEGSRRARDRLVTSAVFGSFLLALIPLLAIV
FT                   VSVVSRGAKRLDGNFLTHSMRSINAREAGGGVYHAIIGTLEQVGLASVMAVPFGLLVAI
FT                   YLVEYGTGRISRVISFFVDVLTGLPSIIAGLFVLGFWILALGQSFSGFAGALALTILMI
FT                   PVVVRSAEEMLKLVPDELREASYALGVARWRTILKVVLPTALPGIVTGVMLAVARVAGE
FT                   TAPLLLTVFGANSINFNPFSGEQSALPLYIYSQAGQPQQVAIDRAWAAALTLIIIIMLL
FT                   NLLARLVARRATIK"
     MSTATTAPPA PVSGGSLNLR GQTLSRPVLG AIAVGAVVLT LLLYLVTSIH SRIQFVLIAL        60
     ILFGIGQTVA SVVVEGSRRA RDRLVTSAVF GSFLLALIPL LAIVVSVVSR GAKRLDGNFL       120
     THSMRSINAR EAGGGVYHAI IGTLEQVGLA SVMAVPFGLL VAIYLVEYGT GRISRVISFF       180
     VDVLTGLPSI IAGLFVLGFW ILALGQSFSG FAGALALTIL MIPVVVRSAE EMLKLVPDEL       240
     REASYALGVA RWRTILKVVL PTALPGIVTG VMLAVARVAG ETAPLLLTVF GANSINFNPF       300
     SGEQSALPLY IYSQAGQPQQ VAIDRAWAAA LTLIIIIMLL NLLARLVARR ATIK             354
//

If you have problems or comments...

PBIL Back to PBIL home page