(data stored in ACNUC7421 zone)

EMBL: CP000820.PE353

CP000820.PE353       Location/Qualifiers
FT   CDS             424695..425768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0356"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: fal:FRAAL6531 putative
FT                   two-component system, regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09822"
FT                   /db_xref="GOA:A8LF77"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF77"
FT                   /protein_id="ABW09822.1"
FT                   /translation="MWPTASGGGDGAVAPAAPDHGQPSPWLLIADDEANDELLPALRGR
FT                   GVEVSVVTDGAQALVEIGRLDPSAVLISARLPVVDGVTVIRTVRSVAGRDTTPILFAVG
FT                   PGDREQAAAALEAGASACVGKPYRLHEVLAMVGAVGGLAAVTAGLGAPGGLGAPGGLSG
FT                   SGTRMTPAAGRAGSFGGPEGAGGFGAGPEHVGGIGGLLAAGGPGRPGLAGALTVPAASS
FT                   VLRSGPVVLDVDAHEVTVDGRAVHMPPREFRLLHLLLGHAGRVVTRETLLTEVWGSADT
FT                   DPNTLAVHVRRLRRRLGDSISGAADGAAQRHDSADAPSVSSRPVVTSRGLIDVHPPLIE
FT                   SIRGIGYRFRAPAPRPT"
     MWPTASGGGD GAVAPAAPDH GQPSPWLLIA DDEANDELLP ALRGRGVEVS VVTDGAQALV        60
     EIGRLDPSAV LISARLPVVD GVTVIRTVRS VAGRDTTPIL FAVGPGDREQ AAAALEAGAS       120
     ACVGKPYRLH EVLAMVGAVG GLAAVTAGLG APGGLGAPGG LSGSGTRMTP AAGRAGSFGG       180
     PEGAGGFGAG PEHVGGIGGL LAAGGPGRPG LAGALTVPAA SSVLRSGPVV LDVDAHEVTV       240
     DGRAVHMPPR EFRLLHLLLG HAGRVVTRET LLTEVWGSAD TDPNTLAVHV RRLRRRLGDS       300
     ISGAADGAAQ RHDSADAPSV SSRPVVTSRG LIDVHPPLIE SIRGIGYRFR APAPRPT          357
//

If you have problems or comments...

PBIL Back to PBIL home page