(data stored in ACNUC7421 zone)

EMBL: CP000820.PE354

CP000820.PE354       Location/Qualifiers
FT   CDS             complement(425875..426786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0357"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: fal:FRAAL6530 A/G-specific adenine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09823"
FT                   /db_xref="GOA:A8LF78"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF78"
FT                   /protein_id="ABW09823.1"
FT                   /translation="MGGVPRLETIPAMTSVRMADEVLEWFAVCARDLPWRRPETTPWGV
FT                   LVSEIMLQQTPVNRVLPVWAEWLSRWPAPADLAAEPSGEAVRAWGRLGYPRRALRLHQA
FT                   ATAMLERHGGAVPDELDDLLALPGVGSYTARAVAAFAFRQRHAVIDVNVRRLVARAVEG
FT                   VAEGPTSVSRRDLALVADLLPADPETAARASAAFMELGALVCVARAPRCAACPVRDRCA
FT                   WLAVGSPPSEGPARRPQGYAGTDRQVRGRLLAVLREATGPVEQADLDAVWDEPVQRDRA
FT                   LAGLLTDGLVSRTAPGVYALPR"
     MGGVPRLETI PAMTSVRMAD EVLEWFAVCA RDLPWRRPET TPWGVLVSEI MLQQTPVNRV        60
     LPVWAEWLSR WPAPADLAAE PSGEAVRAWG RLGYPRRALR LHQAATAMLE RHGGAVPDEL       120
     DDLLALPGVG SYTARAVAAF AFRQRHAVID VNVRRLVARA VEGVAEGPTS VSRRDLALVA       180
     DLLPADPETA ARASAAFMEL GALVCVARAP RCAACPVRDR CAWLAVGSPP SEGPARRPQG       240
     YAGTDRQVRG RLLAVLREAT GPVEQADLDA VWDEPVQRDR ALAGLLTDGL VSRTAPGVYA       300
     LPR                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page