(data stored in ACNUC7421 zone)

EMBL: CP000820.PE358

CP000820.PE358       Location/Qualifiers
FT   CDS             complement(431162..431545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4461 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09827"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF82"
FT                   /protein_id="ABW09827.1"
FT                   /translation="MALRRKLSGCWHQERRDTTVPTPLAPHRPAEGPPEPPSAPGVSRR
FT                   LGGRLPPPPARPLALAVRPKTGRPPRGPKTLFPRALRPFSPGPVESGRPAPRVPGPSRP
FT                   PCSVRATGPSHDEADLPDIRSRR"
     MALRRKLSGC WHQERRDTTV PTPLAPHRPA EGPPEPPSAP GVSRRLGGRL PPPPARPLAL        60
     AVRPKTGRPP RGPKTLFPRA LRPFSPGPVE SGRPAPRVPG PSRPPCSVRA TGPSHDEADL       120
     PDIRSRR                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page