(data stored in ACNUC7421 zone)

EMBL: CP000820.PE36

CP000820.PE36        Location/Qualifiers
FT   CDS             44565..44774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0037"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   fal:FRAAL0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09505"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB44"
FT                   /protein_id="ABW09505.1"
FT                   /translation="MTTHGADAPLNWRKSSYSGGTGGNCVEVATLPDGGRAVRDSKHPD
FT                   GPALHFTATEWAAFLAGTQDGEFD"
     MTTHGADAPL NWRKSSYSGG TGGNCVEVAT LPDGGRAVRD SKHPDGPALH FTATEWAAFL        60
     AGTQDGEFD                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page