(data stored in ACNUC7421 zone)

EMBL: CP000820.PE366

CP000820.PE366       Location/Qualifiers
FT   CDS             complement(438959..440494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0369"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   fal:FRAAL6518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09835"
FT                   /db_xref="GOA:A8LF90"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF90"
FT                   /protein_id="ABW09835.1"
FT                   /translation="MDLNPRHGQGYPGHGYPPERPDSPHPNAGYAENSTHPDGYPGDDL
FT                   PTESYRAEDFRADDQPTESYTPDQFTGSAYPESGYADNGYAENSYPDGAYPGAGYPAGT
FT                   GDYREGDYHHEYPESAYSEPGYQGETYSDDTYSGSGFNEDGYAEDTDPATMLLGQRAVP
FT                   GEADDDAHDEVMRCPVCAAPNYQDARYCEACGFALTGVPVAGGDEDHREIDLGPLAGVC
FT                   DRGVRHTTNEDSMGVAIVHGTLIAVVCDGVSTTPGSGEASAAAAATATAILADAVRAHG
FT                   PGEAVPYDERPASRANDVLDVLEEYSEYDEPRTAPRRISGGFGPDEADIALQRAVEAAQ
FT                   ATIAQLSAAEGRMAPSCTFAAAIITPPSVDGPGMVTVGWVGDSRVYLLGPRWCERLTAD
FT                   DTWAAEAARAGLIPASEAETHRRAHTLTRWLGGDAEDVTPHTAAFPIETPATVLVCSDG
FT                   LWNYSSRPDVLAALVNQLEPSASALDVSRHLIDFAIDQGGHDNITVVAARVTS"
     MDLNPRHGQG YPGHGYPPER PDSPHPNAGY AENSTHPDGY PGDDLPTESY RAEDFRADDQ        60
     PTESYTPDQF TGSAYPESGY ADNGYAENSY PDGAYPGAGY PAGTGDYREG DYHHEYPESA       120
     YSEPGYQGET YSDDTYSGSG FNEDGYAEDT DPATMLLGQR AVPGEADDDA HDEVMRCPVC       180
     AAPNYQDARY CEACGFALTG VPVAGGDEDH REIDLGPLAG VCDRGVRHTT NEDSMGVAIV       240
     HGTLIAVVCD GVSTTPGSGE ASAAAAATAT AILADAVRAH GPGEAVPYDE RPASRANDVL       300
     DVLEEYSEYD EPRTAPRRIS GGFGPDEADI ALQRAVEAAQ ATIAQLSAAE GRMAPSCTFA       360
     AAIITPPSVD GPGMVTVGWV GDSRVYLLGP RWCERLTADD TWAAEAARAG LIPASEAETH       420
     RRAHTLTRWL GGDAEDVTPH TAAFPIETPA TVLVCSDGLW NYSSRPDVLA ALVNQLEPSA       480
     SALDVSRHLI DFAIDQGGHD NITVVAARVT S                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page