(data stored in ACNUC7421 zone)

EMBL: CP000820.PE368

CP000820.PE368       Location/Qualifiers
FT   CDS             complement(441949..443658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09837"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF92"
FT                   /protein_id="ABW09837.1"
FT                   /translation="MPSPGTDDLDAALRALEETVAAQAGVLLDLENSPERALLDPAPLS
FT                   GVTRAEALAVIAVLADVWRAYAALRDVTEAARSLRGRRSRVDARTLTELTALLYGPSVP
FT                   DILPQTKILPAPEIGPVPARHRPERAGQAHPEWVRPEQVRSGQVRPAELARRVDAAVAA
FT                   VRGRMRLILGVRNALLAEIAAGGRAVAETSVLAARLGLAPGDAGLVAARRLLAELSAAA
FT                   RSDPLGVSPGLRARAEAAVAAATRSTGDLARRHDGLDADLAAAGALLAEITRLDDTARR
FT                   DAGLATRRIRGLGPLYRLADNWRDDQQHGLAPWLIRLRAQAAAGRWKESSRGLARWLEV
FT                   AEATHLAAQRIAGANGAALRRREELRGLLGAWEAKAARLGLTADPRLLPLARAARRELY
FT                   SAPTDVERAAGLVNDFGAALAARGGSPAPDALPAPEVLPAPNVSPARLAPPRRPAQRDR
FT                   SGTRTHPIPPPQTAPHPHPHPRPAPAASTTRPIQATPSAPPAPPAELARLAQPTPPGQS
FT                   PSPVQSAPSARPRHPTQPTWPARRTRARRPAGSAGGGKPAGIGSSTRPEAVT"
     MPSPGTDDLD AALRALEETV AAQAGVLLDL ENSPERALLD PAPLSGVTRA EALAVIAVLA        60
     DVWRAYAALR DVTEAARSLR GRRSRVDART LTELTALLYG PSVPDILPQT KILPAPEIGP       120
     VPARHRPERA GQAHPEWVRP EQVRSGQVRP AELARRVDAA VAAVRGRMRL ILGVRNALLA       180
     EIAAGGRAVA ETSVLAARLG LAPGDAGLVA ARRLLAELSA AARSDPLGVS PGLRARAEAA       240
     VAAATRSTGD LARRHDGLDA DLAAAGALLA EITRLDDTAR RDAGLATRRI RGLGPLYRLA       300
     DNWRDDQQHG LAPWLIRLRA QAAAGRWKES SRGLARWLEV AEATHLAAQR IAGANGAALR       360
     RREELRGLLG AWEAKAARLG LTADPRLLPL ARAARRELYS APTDVERAAG LVNDFGAALA       420
     ARGGSPAPDA LPAPEVLPAP NVSPARLAPP RRPAQRDRSG TRTHPIPPPQ TAPHPHPHPR       480
     PAPAASTTRP IQATPSAPPA PPAELARLAQ PTPPGQSPSP VQSAPSARPR HPTQPTWPAR       540
     RTRARRPAGS AGGGKPAGIG SSTRPEAVT                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page