(data stored in ACNUC7421 zone)

EMBL: CP000820.PE37

CP000820.PE37        Location/Qualifiers
FT   CDS             45693..46814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0038"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sen:SACE_2322
FT                   phage-related integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09506"
FT                   /db_xref="GOA:A8LB45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB45"
FT                   /protein_id="ABW09506.1"
FT                   /translation="MVDRESVAGAAGLYLVAGVPLLRADEQVFAAMLEGWGSQQTARNL
FT                   AVGTVEGRVRAVRAFTRHAEAFPWAWTAAMVDEWCTDLRAVRNLRRSTLRNYQEAVRLF
FT                   CVYVTDPAYGWPVRCEQEFGAHPVQICHEWNTTVHAQQSESDPGKRAFTVDELQAFFDY
FT                   ADEQVSRIRAAGRKGWLPAFRDAVLFKVAYAYGLRRREVRMLDLADFGRNPHGPEFGDY
FT                   GVCQVRFGKASKGSPPKRRGVLTVWTWTPEILAEWVEEFRPLLAPQDCPALWPSERAPR
FT                   VALTQINARFSTYRDALGLDPALDVHSLRRSYVTHLIEDGYDALFVQQQVGHEHASTTA
FT                   IYICVSSDFRTRTLRRALDQTLAAALTPTEKAR"
     MVDRESVAGA AGLYLVAGVP LLRADEQVFA AMLEGWGSQQ TARNLAVGTV EGRVRAVRAF        60
     TRHAEAFPWA WTAAMVDEWC TDLRAVRNLR RSTLRNYQEA VRLFCVYVTD PAYGWPVRCE       120
     QEFGAHPVQI CHEWNTTVHA QQSESDPGKR AFTVDELQAF FDYADEQVSR IRAAGRKGWL       180
     PAFRDAVLFK VAYAYGLRRR EVRMLDLADF GRNPHGPEFG DYGVCQVRFG KASKGSPPKR       240
     RGVLTVWTWT PEILAEWVEE FRPLLAPQDC PALWPSERAP RVALTQINAR FSTYRDALGL       300
     DPALDVHSLR RSYVTHLIED GYDALFVQQQ VGHEHASTTA IYICVSSDFR TRTLRRALDQ       360
     TLAAALTPTE KAR                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page