(data stored in ACNUC7421 zone)

EMBL: CP000820.PE373

CP000820.PE373       Location/Qualifiers
FT   CDS             complement(448085..449041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0376"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: nfa:nfa34480 putative ABC transporter
FT                   ATP-binding protein; TIGRFAM: daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09842"
FT                   /db_xref="GOA:A8LF97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF97"
FT                   /protein_id="ABW09842.1"
FT                   /translation="MTATNPAIEVSGLTKSYGDHAVLDGVDLTVPEGTVYALLGPNGAG
FT                   KTTIVNILSALLTPGDGEIRVAGFDVRREPAGVRAAIGVTGQFSAIDELLTGRENLRLM
FT                   ADLAHLDRVTATAAVTVMLERFDLVDAADRRAQTYSGGMKRRLDLAMTLIARPRLIFLD
FT                   EPTAGLDPRSRRDLWAIVREQVADGVTVLLTTQYLDEADQLADRIGVLDGGRLVAEGTA
FT                   AELKRRVPGGHVSVQFTDAAGLAAAAAAHPEATTDAEALTLRVPGDGSIAGLRRVLDGL
FT                   DDDDVAGLTVESPDLDDVFLALTGHATEAPAAEEIPA"
     MTATNPAIEV SGLTKSYGDH AVLDGVDLTV PEGTVYALLG PNGAGKTTIV NILSALLTPG        60
     DGEIRVAGFD VRREPAGVRA AIGVTGQFSA IDELLTGREN LRLMADLAHL DRVTATAAVT       120
     VMLERFDLVD AADRRAQTYS GGMKRRLDLA MTLIARPRLI FLDEPTAGLD PRSRRDLWAI       180
     VREQVADGVT VLLTTQYLDE ADQLADRIGV LDGGRLVAEG TAAELKRRVP GGHVSVQFTD       240
     AAGLAAAAAA HPEATTDAEA LTLRVPGDGS IAGLRRVLDG LDDDDVAGLT VESPDLDDVF       300
     LALTGHATEA PAAEEIPA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page