(data stored in ACNUC7421 zone)

EMBL: CP000820.PE375

CP000820.PE375       Location/Qualifiers
FT   CDS             452989..454416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0378"
FT                   /product="diguanylate phosphodiesterase with GAF sensor(s)"
FT                   /note="PFAM: EAL domain protein; GAF domain protein; KEGG:
FT                   fal:FRAAL3921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09844"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF99"
FT                   /protein_id="ABW09844.1"
FT                   /translation="MSVFASGAGSQDPRDGRDGRDRRRGRDRRVGGRVRERTDEVARVL
FT                   DLARRHLGTDVAWLSRFTGDEQVIDLISGEGELVERLVGRQVEQEATYCARVLDGRLPA
FT                   VIPDARADQRTAALAVTRELGIGSYVGAPVYLDSGEVYGMLCALSTEPDPGLGDREARF
FT                   LGLLADVVADAVSALHRGGADDDHIRSVIAQVIARGGPVMVFQPVFDLPTHGLVGAEAL
FT                   ARFPTFPAPSGEPAGDLGEETGDQAGGAAGEEADDRTAAGPYFGDLPPDRWFAHAASVG
FT                   MGIDLELAAIRAAVAELPRFPRGLSLAVNASPATIASGRLGELLAATATDQLIVEITER
FT                   DGIHDLPSTLARLYELREMGVRIAVDNVGVAYASLRRLVQILPDVVKMNLWLTTDIGAD
FT                   AARRALVEALVHFSRQIGACLVAEGIQRANELRVLTAAGVDQGQGEFLGPPGPLPLPVH
FT                   GRCVPASHGPLVSARAS"
     MSVFASGAGS QDPRDGRDGR DRRRGRDRRV GGRVRERTDE VARVLDLARR HLGTDVAWLS        60
     RFTGDEQVID LISGEGELVE RLVGRQVEQE ATYCARVLDG RLPAVIPDAR ADQRTAALAV       120
     TRELGIGSYV GAPVYLDSGE VYGMLCALST EPDPGLGDRE ARFLGLLADV VADAVSALHR       180
     GGADDDHIRS VIAQVIARGG PVMVFQPVFD LPTHGLVGAE ALARFPTFPA PSGEPAGDLG       240
     EETGDQAGGA AGEEADDRTA AGPYFGDLPP DRWFAHAASV GMGIDLELAA IRAAVAELPR       300
     FPRGLSLAVN ASPATIASGR LGELLAATAT DQLIVEITER DGIHDLPSTL ARLYELREMG       360
     VRIAVDNVGV AYASLRRLVQ ILPDVVKMNL WLTTDIGADA ARRALVEALV HFSRQIGACL       420
     VAEGIQRANE LRVLTAAGVD QGQGEFLGPP GPLPLPVHGR CVPASHGPLV SARAS            475
//

If you have problems or comments...

PBIL Back to PBIL home page