(data stored in ACNUC7421 zone)

EMBL: CP000820.PE379

CP000820.PE379       Location/Qualifiers
FT   CDS             complement(458620..459447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09848"
FT                   /db_xref="GOA:A8LFA3"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA3"
FT                   /protein_id="ABW09848.1"
FT                   /translation="MSANHDHTDLHHSRHLGQERGRPGTGPPARSAVGSPRPPRRRVRR
FT                   RYRLVVLALVSAGGMAALAGLWAVISLSTEDGPTRWRDGTRHGPWLAVFDGYGRTAGQL
FT                   EAGGLVITLTPRTADAPERTHAGLVVSSEHYSDVRFTTQVRTVRQLRHGTPAPWEVGWV
FT                   LWNYTDPAHFYAFALKPNGWELSKQDPAYPGGQRFLASGPAPRARLGSWHTVEVIHDRD
FT                   SMAVSVDGVPTVRMQDTERPYVSGAVGLYCEDSVVEFRRSGARHLRPADQPPF"
     MSANHDHTDL HHSRHLGQER GRPGTGPPAR SAVGSPRPPR RRVRRRYRLV VLALVSAGGM        60
     AALAGLWAVI SLSTEDGPTR WRDGTRHGPW LAVFDGYGRT AGQLEAGGLV ITLTPRTADA       120
     PERTHAGLVV SSEHYSDVRF TTQVRTVRQL RHGTPAPWEV GWVLWNYTDP AHFYAFALKP       180
     NGWELSKQDP AYPGGQRFLA SGPAPRARLG SWHTVEVIHD RDSMAVSVDG VPTVRMQDTE       240
     RPYVSGAVGL YCEDSVVEFR RSGARHLRPA DQPPF                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page