(data stored in ACNUC7421 zone)

EMBL: CP000820.PE38

CP000820.PE38        Location/Qualifiers
FT   CDS             46811..47149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0039"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: stp:Strop_2907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09507"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB46"
FT                   /protein_id="ABW09507.1"
FT                   /translation="MTIRRQVSYQWRLREVMATRGLFTITDLVPLLAERGITLSASQVH
FT                   RIVTGTPERLSLPVLAALCDILEVTPAELIVTRAVNATLRRAAAGDVPAPVDLAGEIRP
FT                   KRARLRPE"
     MTIRRQVSYQ WRLREVMATR GLFTITDLVP LLAERGITLS ASQVHRIVTG TPERLSLPVL        60
     AALCDILEVT PAELIVTRAV NATLRRAAAG DVPAPVDLAG EIRPKRARLR PE               112
//

If you have problems or comments...

PBIL Back to PBIL home page