(data stored in ACNUC7421 zone)

EMBL: CP000820.PE384

CP000820.PE384       Location/Qualifiers
FT   CDS             complement(463343..463774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09853"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA8"
FT                   /protein_id="ABW09853.1"
FT                   /translation="MFDLSCSCMVHTDDEPDTIRNIAIIKPIHTNRSPPALRAESGRRR
FT                   RLEPARPTPRARGAPLRAAARRPAPAPVHAQNRYPPVTWPDGPRSAGNRRHGLAGTHSA
FT                   RPPGDAGGRFEDDVDDGCRRNDQPDCVCSLSRHGTFAMM"
     MFDLSCSCMV HTDDEPDTIR NIAIIKPIHT NRSPPALRAE SGRRRRLEPA RPTPRARGAP        60
     LRAAARRPAP APVHAQNRYP PVTWPDGPRS AGNRRHGLAG THSARPPGDA GGRFEDDVDD       120
     GCRRNDQPDC VCSLSRHGTF AMM                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page