(data stored in ACNUC7421 zone)

EMBL: CP000820.PE387

CP000820.PE387       Location/Qualifiers
FT   CDS             468767..469177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0390"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   fal:FRAAL4396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09856"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB1"
FT                   /protein_id="ABW09856.1"
FT                   /translation="MPRQPDLSFLLDRLRETVPDILCAVVLSSDGLLLATSTGIDRAAA
FT                   DQLAAVASGFDALARGAARQHGWGQVNKTMVDMENGYLFITAVGHSACLAVSSTADADV
FT                   GQIAYEMAHLVSRAGRFLTPELRNQMRAALPS"
     MPRQPDLSFL LDRLRETVPD ILCAVVLSSD GLLLATSTGI DRAAADQLAA VASGFDALAR        60
     GAARQHGWGQ VNKTMVDMEN GYLFITAVGH SACLAVSSTA DADVGQIAYE MAHLVSRAGR       120
     FLTPELRNQM RAALPS                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page