(data stored in ACNUC7421 zone)

EMBL: CP000820.PE388

CP000820.PE388       Location/Qualifiers
FT   CDS             469212..469604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0391"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742; KEGG:
FT                   fal:FRAAL4395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09857"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB2"
FT                   /protein_id="ABW09857.1"
FT                   /translation="MAGDWSGSTGLGDSWDESEPLVRPYAVTRGRTAPAVPLELVALVA
FT                   TTDSGMAAIRRRGRLAPEEHDIAILCMRIHSIAEISARLKLPLMVVRVLIDDMARDGMV
FT                   SVHRPENPDRPSPELLRRVLHGLTRL"
     MAGDWSGSTG LGDSWDESEP LVRPYAVTRG RTAPAVPLEL VALVATTDSG MAAIRRRGRL        60
     APEEHDIAIL CMRIHSIAEI SARLKLPLMV VRVLIDDMAR DGMVSVHRPE NPDRPSPELL       120
     RRVLHGLTRL                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page