(data stored in ACNUC7421 zone)

EMBL: CP000820.PE389

CP000820.PE389       Location/Qualifiers
FT   CDS             469585..470178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0392"
FT                   /product="protein of unknown function ATP binding"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   fal:FRAAL4394 conserved hypothetical protein; putative
FT                   ATP/GTP-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09858"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB3"
FT                   /protein_id="ABW09858.1"
FT                   /translation="MVSPVSKRAPTAVKVLVAGGFGVGKTTFVGSVSEIEPLTTEAALT
FT                   SASLGVDDTSAVHGKTTTTVAMDFGRLTLSNNIILYLFGTPGQDRFWFMWDELVRGAIG
FT                   AVVLVDTRRMADSFPAIDFFENRRVPFLVAVNRFDANTYEYPLPMVRNAADLAPHRPLM
FT                   YCDARRPDSAQTTLVHLVRHALELALSGDLPDEP"
     MVSPVSKRAP TAVKVLVAGG FGVGKTTFVG SVSEIEPLTT EAALTSASLG VDDTSAVHGK        60
     TTTTVAMDFG RLTLSNNIIL YLFGTPGQDR FWFMWDELVR GAIGAVVLVD TRRMADSFPA       120
     IDFFENRRVP FLVAVNRFDA NTYEYPLPMV RNAADLAPHR PLMYCDARRP DSAQTTLVHL       180
     VRHALELALS GDLPDEP                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page