(data stored in ACNUC7421 zone)

EMBL: CP000820.PE39

CP000820.PE39        Location/Qualifiers
FT   CDS             47146..48660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_2905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09508"
FT                   /db_xref="GOA:A8LB47"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB47"
FT                   /protein_id="ABW09508.1"
FT                   /translation="MTARTGRYTAEQYERWHIRVCARCGRRASLSANWSDGPICRSCYD
FT                   RAARTYGRCPGCQAERLLPGRDDDGAALCRDCAGITRDFFCSRCGFEGLLLGGRLCERC
FT                   TLTDQLAAALDDGTGNVSPPLVPLLDALRVMPKPKSGLAWLRNPRVRELLADLATGRVA
FT                   LTHEALHALPNWRTVAYLRDLLMACGVLPAVDKQLLHHETWLHRQLAELDGHPHARLLR
FT                   QFGTWAQLPRLRHRAAARPLTPHARKEAAAQFTQARLFLAWLDERDRTPETLTRTDVDV
FT                   WHATHLDHAKRSLRTFLTWAMDSGHLPCLDLPRLQIVRAEPLTQRRRLDLVKSVLTSET
FT                   GSPPTRAAACLMLLYAQPASRIVRLTVDDLTRDGDQVLLRLGDPPVPVPDPFATLLLTA
FT                   ATRRDNMTTATNPDSRWLFPGRRAGQPLHPCSLLDQIRALGIPIQAARTAALRQLVLQA
FT                   PAPVVAQALGYHPITTQWHRADAGGTWTHYAPGDHAGPSPTPPVIT"
     MTARTGRYTA EQYERWHIRV CARCGRRASL SANWSDGPIC RSCYDRAART YGRCPGCQAE        60
     RLLPGRDDDG AALCRDCAGI TRDFFCSRCG FEGLLLGGRL CERCTLTDQL AAALDDGTGN       120
     VSPPLVPLLD ALRVMPKPKS GLAWLRNPRV RELLADLATG RVALTHEALH ALPNWRTVAY       180
     LRDLLMACGV LPAVDKQLLH HETWLHRQLA ELDGHPHARL LRQFGTWAQL PRLRHRAAAR       240
     PLTPHARKEA AAQFTQARLF LAWLDERDRT PETLTRTDVD VWHATHLDHA KRSLRTFLTW       300
     AMDSGHLPCL DLPRLQIVRA EPLTQRRRLD LVKSVLTSET GSPPTRAAAC LMLLYAQPAS       360
     RIVRLTVDDL TRDGDQVLLR LGDPPVPVPD PFATLLLTAA TRRDNMTTAT NPDSRWLFPG       420
     RRAGQPLHPC SLLDQIRALG IPIQAARTAA LRQLVLQAPA PVVAQALGYH PITTQWHRAD       480
     AGGTWTHYAP GDHAGPSPTP PVIT                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page