(data stored in ACNUC7421 zone)

EMBL: CP000820.PE391

CP000820.PE391       Location/Qualifiers
FT   CDS             470606..471238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_1321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09860"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB5"
FT                   /protein_id="ABW09860.1"
FT                   /translation="MTLLLLTTEAAVVFGVSTYLLLRTWTRYRAVTMADVFFYDHADGA
FT                   RLPCSRSAGPRVLGEHVVAGFERSPLGAVIAAINLAHRATSTVGAAGVGGVGGVGGFGG
FT                   AAGAVGGKPVPGGGNGPSGTSWYQVQIIGWEVERYSSRKAAIRYLLTRSVDGGDAVTTT
FT                   MRVEVSWVGADWRVVDPPSGDWTHAFFLGDDVSGFSCFPSEFRFPVP"
     MTLLLLTTEA AVVFGVSTYL LLRTWTRYRA VTMADVFFYD HADGARLPCS RSAGPRVLGE        60
     HVVAGFERSP LGAVIAAINL AHRATSTVGA AGVGGVGGVG GFGGAAGAVG GKPVPGGGNG       120
     PSGTSWYQVQ IIGWEVERYS SRKAAIRYLL TRSVDGGDAV TTTMRVEVSW VGADWRVVDP       180
     PSGDWTHAFF LGDDVSGFSC FPSEFRFPVP                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page