(data stored in ACNUC7421 zone)

EMBL: CP000820.PE393

CP000820.PE393       Location/Qualifiers
FT   CDS             472073..472792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1508 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09862"
FT                   /db_xref="GOA:A8LGC3"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC3"
FT                   /protein_id="ABW09862.1"
FT                   /translation="MWRVSESMDSLTRHSFVIGVFPGHAGAGLLPYPWRMFRNFEGAHP
FT                   ARCRCSPGRGWDARAAGCPGHQPGASQIAASGPKSRSSAVVCPTVISAGGGTSMTDAMV
FT                   FCAAFIALFTGHHLGDHVAQTDRQATEKDGRGWPAARAMTGHLFAYHLCVAAALASLLI
FT                   IDVPLRLPGVIAALGWSIVTHGFIDRRWPVRWLLRRSGAARFAELKSSGLNGMYLADQS
FT                   LHIGCLFIGALLAAGLS"
     MWRVSESMDS LTRHSFVIGV FPGHAGAGLL PYPWRMFRNF EGAHPARCRC SPGRGWDARA        60
     AGCPGHQPGA SQIAASGPKS RSSAVVCPTV ISAGGGTSMT DAMVFCAAFI ALFTGHHLGD       120
     HVAQTDRQAT EKDGRGWPAA RAMTGHLFAY HLCVAAALAS LLIIDVPLRL PGVIAALGWS       180
     IVTHGFIDRR WPVRWLLRRS GAARFAELKS SGLNGMYLAD QSLHIGCLFI GALLAAGLS        239
//

If you have problems or comments...

PBIL Back to PBIL home page