(data stored in ACNUC7421 zone)

EMBL: CP000820.PE397

CP000820.PE397       Location/Qualifiers
FT   CDS             479870..480388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09866"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC7"
FT                   /protein_id="ABW09866.1"
FT                   /translation="MGGDGARQQGLFDVAGEVTAAEPVLMALHAEYYELIWQGLKTHEF
FT                   RRRFLEGRPVRWFVYLNAPVSRLAAVIDLGPAVVDVPERVAAIAERARVGNGASVLEYV
FT                   RDLERAFAIPILGVSEYSGRSVEELRAELGGFHPPQGYVRLRQHPQLLTVCEKITTESP
FT                   LREMSVHHH"
     MGGDGARQQG LFDVAGEVTA AEPVLMALHA EYYELIWQGL KTHEFRRRFL EGRPVRWFVY        60
     LNAPVSRLAA VIDLGPAVVD VPERVAAIAE RARVGNGASV LEYVRDLERA FAIPILGVSE       120
     YSGRSVEELR AELGGFHPPQ GYVRLRQHPQ LLTVCEKITT ESPLREMSVH HH               172
//

If you have problems or comments...

PBIL Back to PBIL home page