(data stored in ACNUC7421 zone)

EMBL: CP000820.PE4

CP000820.PE4         Location/Qualifiers
FT   CDS             5118..6491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sen:SACE_0005 DNA
FT                   replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09473"
FT                   /db_xref="GOA:A8LB19"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB19"
FT                   /protein_id="ABW09473.1"
FT                   /translation="MHLTHLSLTDFRSYARLDLVLEPGVTTFVGSNGQGKTNLIEAIGF
FT                   VATLGSHRVANDAPLVREGCGQAVVRARIVRGDRAALVEMQIVPGKANRVRLNRAPVAR
FT                   ARDVAGLLATVLFAPEDLALVKGDPAERRRFLDDLLVARAPRMAAVQSDYDRVLKQRSA
FT                   LLRSAGAARRAGGRGDLRTLDVWDRHLADHGAELLAARLALVEELRPRVESAYAAVAGQ
FT                   DAPTGIEYRSTVTLDSSPDRALSPGRAGLGEPDGDAGRNGNGASPNHPSGSGDPASGNG
FT                   GSGDTEVGDTEAGRTGDGAGDGRTEADRTEVGHVGGAVGGTATRAALEEAILAGLAAVR
FT                   TQEIERGVTLVGPHRDDLLLSVNGRPARGYASHGESWSLALALRLASFELLRADDREPV
FT                   LLLDDVFAELDTRRRARLAALVADAEQVLVTAAVDADVPAELAGVRFEVVSGEVCRAG"
     MHLTHLSLTD FRSYARLDLV LEPGVTTFVG SNGQGKTNLI EAIGFVATLG SHRVANDAPL        60
     VREGCGQAVV RARIVRGDRA ALVEMQIVPG KANRVRLNRA PVARARDVAG LLATVLFAPE       120
     DLALVKGDPA ERRRFLDDLL VARAPRMAAV QSDYDRVLKQ RSALLRSAGA ARRAGGRGDL       180
     RTLDVWDRHL ADHGAELLAA RLALVEELRP RVESAYAAVA GQDAPTGIEY RSTVTLDSSP       240
     DRALSPGRAG LGEPDGDAGR NGNGASPNHP SGSGDPASGN GGSGDTEVGD TEAGRTGDGA       300
     GDGRTEADRT EVGHVGGAVG GTATRAALEE AILAGLAAVR TQEIERGVTL VGPHRDDLLL       360
     SVNGRPARGY ASHGESWSLA LALRLASFEL LRADDREPVL LLDDVFAELD TRRRARLAAL       420
     VADAEQVLVT AAVDADVPAE LAGVRFEVVS GEVCRAG                                457
//

If you have problems or comments...

PBIL Back to PBIL home page